PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00102858001
Common NameGSBRNA2T00102858001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TALE
Protein Properties Length: 507aa    MW: 57181.9 Da    PI: 5.7938
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00102858001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.14e-103433801954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  GSBRNA2T00102858001 343 FEHflHPYPKESEKMMLAKQTGLSKNQVANWFINARVR 380
                          554459******************************88 PP

2BELL112.13e-36201272172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          erqel++kk kLl++l+eVdkrY+qy++q+++++ssFe+vag gs kpYts+Al++iS hFr+L+dai+eqi
  GSBRNA2T00102858001 201 ERQELRSKKDKLLTMLDEVDKRYNQYYHQMEALASSFEVVAGFGSPKPYTSVALNRISCHFRALRDAIKEQI 272
                          79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.8E-44136270IPR006563POX domain
PfamPF075263.8E-44141268IPR006563POX domain
PROSITE profilePS5007112.179321384IPR001356Homeobox domain
CDDcd000862.85E-11324385No hitNo description
SMARTSM003891.5E-9324388IPR001356Homeobox domain
SuperFamilySSF466892.18E-17326391IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-27327390IPR009057Homeodomain-like
PfamPF059208.5E-18341380IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MAVYYPSNVN CYQQEPIYLN HHHHQQQQQP SSSSAAAAAA SFVGGEENVR NEMVFIPPTG  60
LQNLNGDVPV SSSELTFRDG QGLSLSLLGT QISLPSFHYH QYSSISAKET PPFNKEMLLL  120
GQSDPSSGYA GVYNSYNMSS VLRSRYLKPA QGLLDEVVSV EKEMNQLRKK KKGEDFNNSA  180
KETEGGGGIG GEISIELSTI ERQELRSKKD KLLTMLDEVD KRYNQYYHQM EALASSFEVV  240
AGFGSPKPYT SVALNRISCH FRALRDAIKE QIKMIREKLG EKGGELSLDE QQGGERIPRL  300
RYLDQRLRQQ RALHQQLGMV RPCWRPQRGL PESSVSALRA WLFEHFLHPY PKESEKMMLA  360
KQTGLSKNQV ANWFINARVR LWKPMIEEMY KEEFGDDASE LLTSKSPNST NQEDSSSQQQ  420
QQQENTTNVA FSSEPKPDCT QANEDDPQLH QMNRSGDYDT LMNYQGPNGQ PCLIDTVEFD  480
ILSNMMQAVD EERYDEAGKA RLSASH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A7e-16330388563Homeobox protein Meis2
4xrm_B7e-16330388563Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.200692e-58leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00102858001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5705080.0AY570508.1 Arabidopsis thaliana BEL1-like homeodomain 5 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009110263.10.0PREDICTED: BEL1-like homeodomain protein 10
RefseqXP_009110262.10.0PREDICTED: BEL1-like homeodomain protein 10
SwissprotQ9FXG80.0BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLA0A078EBA40.0A0A078EBA4_BRANA; BnaA08g21960D protein
STRINGBra016497.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19700.31e-178BEL1-like homeodomain 10
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]